Nmr structure of p75 transmembrane domain in dpc micelles
PDB DOI: 10.2210/pdb2mic/pdb
Classification: MEMBRANE PROTEIN Organism(s): Rattus Norvegicus
Deposited: 2013-12-12 Deposition Author(s): Arseniev, A. , Goncharuk, S. , Mineev, K. , Nadezhdin, K.
Method: SOLUTION NMR Resolution: N.A.
Nmr structure of p75 transmembrane domain in dpc micelles
Arseniev, A. , Goncharuk, S. , Mineev, K. , Nadezhdin, K.
Primary Citation of Related Structures: 2MIC
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Tumor necrosis factor receptor superfamily member 16 | A | 41 | Rattus Norvegicus | MTRGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSSKQNKQ |
Tumor necrosis factor receptor superfamily member 16 | B | 41 | Rattus Norvegicus | MTRGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSSKQNKQ |
Method: SOLUTION NMR
Deposited Date: 2013-12-12 Deposition Author(s): Arseniev, A. , Goncharuk, S. , Mineev, K. , Nadezhdin, K.