Solution structure of allatide c4, conformation 1
PDB DOI: 10.2210/pdb2mi9/pdb
Classification: HYDROLASE INHIBITOR Organism(s): Allamanda Cathartica
Deposited: 2013-12-12 Deposition Author(s): Bai, Y. , Pervushin, K.
Solution structure of allatide c4, conformation 1
Primary Citation of Related Structures: 2MI9
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
alpha amylase inhibitor | A | 30 | Allamanda Cathartica | CIAHYGKCDGIINQCCDPWLCTPPIIGFCL |
Method: SOLUTION NMR
Deposited Date: 2013-12-12 Deposition Author(s): Bai, Y. , Pervushin, K.