2MHO
Solution state structure psd-95 pdz1 with 5ht2c receptor peptide
PDB DOI: 10.2210/pdb2mho/pdb
Classification: PROTEIN BINDING Organism(s): Pandinus Imperator , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2013-11-29 Deposition Author(s): Dorr, L.A. , Lian, L. , Phelan, M.M.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Solution state structure psd-95 pdz1 with 5ht2c receptor peptide
Dorr, L.A. , Lian, L. , Phelan, M.M.
Primary Citation of Related Structures: 2MHO
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Disks large homolog 4 | A | 99 | Pandinus Imperator , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GAMEMEYEEITLERGNSGLGFSIAGGTDNPHIGDDPSIFITKIIPGGAAAQDGRLRVNDSILFVNEVDVREVTHSAAVEALKEAGSIVRLYVMRRKPPA |
| peptide from 5-hydroxytryptamine receptor 2C | B | 9 | Pandinus Imperator , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | VVSERISSV |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2013-11-29 Deposition Author(s): Dorr, L.A. , Lian, L. , Phelan, M.M.