Solution structure of blo t 19, a minor dust mite allergen from blomia tropicalis
PDB DOI: 10.2210/pdb2mfj/pdb
Classification: ALLERGEN Organism(s): Roseovarius Nubinhibens (Strain Atcc Baa-591 / Dsm 15170 / Ism)
Deposited: 2013-10-15 Deposition Author(s): Huang, T. , Naik, M.T. , Naik, N.
Solution structure of blo t 19, a minor dust mite allergen from blomia tropicalis
Huang, T. , Naik, M.T. , Naik, N.
Primary Citation of Related Structures: 2MFJ
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Blo t 19 | A | 68 | Roseovarius Nubinhibens (Strain Atcc Baa-591 / Dsm 15170 / Ism) | GSALDFTSCARMNDGALGAKVAQAACISSCKFQNCGTGHCERRGGRPTCVCSRCGNGGGEWPNLPSRG |
Method: SOLUTION NMR
Deposited Date: 2013-10-15 Deposition Author(s): Huang, T. , Naik, M.T. , Naik, N.