1h, 13c, 15n chemical shift assignments of streptomyces virginiae vira acp5a
PDB DOI: 10.2210/pdb2mf4/pdb
Classification: TRANSFERASE Organism(s): Streptomyces Virginiae
Deposited: 2013-10-05 Deposition Author(s): Chagot, B. , Davison, J. , Dorival, J. , Gruez, A. , Mazon, H. , Rabeharindranto, M.H. , Weissman, K.J.
1h, 13c, 15n chemical shift assignments of streptomyces virginiae vira acp5a
Chagot, B. , Davison, J. , Dorival, J. , Gruez, A. , Mazon, H. , Rabeharindranto, M.H. , Weissman, K.J.
Primary Citation of Related Structures: 2MF4
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Hybrid polyketide synthase-non ribosomal peptide synthetase | A | 85 | Streptomyces Virginiae | GPGSAGRQEEIAEEVARLLAGVLYLEPDRLDPEETFLTLGVDSILGVEFVAAVNAAYPVGVKATALYDHPTPAAFARHIAESLGA |
Method: SOLUTION NMR
Deposited Date: 2013-10-05 Deposition Author(s): Chagot, B. , Davison, J. , Dorival, J. , Gruez, A. , Mazon, H. , Rabeharindranto, M.H. , Weissman, K.J.