Structural basis of the non-coding rna rsmz acting as protein sponge: conformer l of rsmz(1-72)/rsme(dimer) 1to3 complex
PDB DOI: 10.2210/pdb2mf0/pdb
Classification: RNA BINDING PROTEIN/RNA Organism(s): Pseudomonas Protegens Pf-5 , Synthetic Construct
Deposited: 2013-10-02 Deposition Author(s): Allain, F.H.-T. , Duss, O. , Jeschke, G. , Michel, E. , Schubert, M. , Yulikov, M.
Method: SOLUTION NMR Resolution: N.A.
Structural basis of the non-coding rna rsmz acting as protein sponge: conformer l of rsmz(1-72)/rsme(dimer) 1to3 complex
Allain, F.H.-T. , Duss, O. , Jeschke, G. , Michel, E. , Schubert, M. , Yulikov, M.
Primary Citation of Related Structures: 2MF0
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Carbon storage regulator homolog | A | 70 | Pseudomonas Protegens Pf-5 , Synthetic Construct | MLILTRKVGESINIGDDITITILGVSGQQVRIGINAPKDVAVHREEIYQRIQAGLTAPDKRETPHHHHHH |
| Carbon storage regulator homolog | B | 70 | Pseudomonas Protegens Pf-5 , Synthetic Construct | MLILTRKVGESINIGDDITITILGVSGQQVRIGINAPKDVAVHREEIYQRIQAGLTAPDKRETPHHHHHH |
| Carbon storage regulator homolog | C | 70 | Pseudomonas Protegens Pf-5 , Synthetic Construct | MLILTRKVGESINIGDDITITILGVSGQQVRIGINAPKDVAVHREEIYQRIQAGLTAPDKRETPHHHHHH |
| Carbon storage regulator homolog | D | 70 | Pseudomonas Protegens Pf-5 , Synthetic Construct | MLILTRKVGESINIGDDITITILGVSGQQVRIGINAPKDVAVHREEIYQRIQAGLTAPDKRETPHHHHHH |
| Carbon storage regulator homolog | E | 70 | Pseudomonas Protegens Pf-5 , Synthetic Construct | MLILTRKVGESINIGDDITITILGVSGQQVRIGINAPKDVAVHREEIYQRIQAGLTAPDKRETPHHHHHH |
| Carbon storage regulator homolog | F | 70 | Pseudomonas Protegens Pf-5 , Synthetic Construct | MLILTRKVGESINIGDDITITILGVSGQQVRIGINAPKDVAVHREEIYQRIQAGLTAPDKRETPHHHHHH |
| Nucleic Acids / Hybrid | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| RNA_(72-MER) | g | 72 | NA | UGUCGACGGAUAGACACAGCCAUCAAGGACGAUGGUCAGGACAUCGCAGGAAGCGAUUCAUCAGGACGAUGA |
Method: SOLUTION NMR
Deposited Date: 2013-10-02 Deposition Author(s): Allain, F.H.-T. , Duss, O. , Jeschke, G. , Michel, E. , Schubert, M. , Yulikov, M.