Nmr solution structure of the gs-tamapin mutation r13a
PDB DOI: 10.2210/pdb2men/pdb
Classification: TOXIN Organism(s): Mesobuthus Tamulus
Deposited: 2013-09-24 Deposition Author(s): Del Rio-Portilla, F. , Ramirez-Cordero, B.
Method: SOLUTION NMR Resolution: N.A.
Nmr solution structure of the gs-tamapin mutation r13a
Del Rio-Portilla, F. , Ramirez-Cordero, B.
Primary Citation of Related Structures: 2MEN
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Potassium channel toxin alpha-KTx 5.4 | A | 33 | Mesobuthus Tamulus | GSAFCNLRRCELSCASLGLLGKCIGEECKCVPY |
Method: SOLUTION NMR
Deposited Date: 2013-09-24 Deposition Author(s): Del Rio-Portilla, F. , Ramirez-Cordero, B.