Nmr structure of a two-transmembrane segment tm vi-vii of nhe1
PDB DOI: 10.2210/pdb2mdf/pdb
Classification: PROTON TRANSPORT Organism(s): Homo Sapiens
Deposited: 2013-09-10 Deposition Author(s): Alves, C. , Fliegel, L. , Lee, B.L. , Sykes, B.D.
Nmr structure of a two-transmembrane segment tm vi-vii of nhe1
Alves, C. , Fliegel, L. , Lee, B.L. , Sykes, B.D.
Primary Citation of Related Structures: 2MDF
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Sodium/hydrogen exchanger 1 | A | 57 | Homo Sapiens | GSKKKDNLLFGSIISAVDPVAVLAVFEEIHINELLHILVFGESLLNDAVTVVLYKKK |
Method: SOLUTION NMR
Deposited Date: 2013-09-10 Deposition Author(s): Alves, C. , Fliegel, L. , Lee, B.L. , Sykes, B.D.