Structure of salmonella mgtr
PDB DOI: 10.2210/pdb2mc7/pdb
Classification: MEMBRANE PROTEIN
Organism(s): N.A.
Deposited: 2013-08-15
Deposition Author(s): Cross, T. , Dai, J. , Fajer, P. , Jean-Francois, F. , Myrick, A. , Rubin, E. , Song, L. , Yu, L. , Zhou, H.
Structure of salmonella mgtr
Cross, T. , Dai, J. , Fajer, P. , Jean-Francois, F. , Myrick, A. , Rubin, E. , Song, L. , Yu, L. , Zhou, H.
Primary Citation of Related Structures: 2MC7
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Regulatory peptide | A | 30 | N.A. | MNRSPDKIIALIFLLISLLVLCLALWQIVF |
Method: SOLID-STATE NMR
Deposited Date: 2013-08-15
Deposition Author(s): Cross, T. , Dai, J. , Fajer, P. , Jean-Francois, F. , Myrick, A. , Rubin, E. , Song, L. , Yu, L. , Zhou, H.