Nmr solution structure of the winged-helix domain from mus81 structure-specific endonuclease
PDB DOI: 10.2210/pdb2mc3/pdb
Classification: HYDROLASE Organism(s): Homo Sapiens
Deposited: 2013-08-14 Deposition Author(s): Fadden, A. , Harris, R. , Mcdonald, N.Q.
Nmr solution structure of the winged-helix domain from mus81 structure-specific endonuclease
Fadden, A. , Harris, R. , Mcdonald, N.Q.
Primary Citation of Related Structures: 2MC3
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| MUS81 endonuclease homolog (Yeast), isoform CRA_b | A | 109 | Homo Sapiens | GPTMGSGSYWPARHSGARVILLVLYREHLNPNGHHFLTKEELLQRCAQKSPRVAPGSAPPWPALRSLLHRNLVLRTHQPARYSLTPEGLELAQKLAESEGLSLLNVGIG |
Method: SOLUTION NMR
Deposited Date: 2013-08-14 Deposition Author(s): Fadden, A. , Harris, R. , Mcdonald, N.Q.