2MC1
Solution structure of the vav1 sh2 domain complexed with a syk-derived singly phosphorylated peptide
PDB DOI: 10.2210/pdb2mc1/pdb
Classification: SIGNALING PROTEIN/PROTEIN BINDING Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2013-08-13 Deposition Author(s): Chen, C. , Geahlen, R.L. , Gorenstein, N.M. , Piraner, D. , Post, C.B.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Solution structure of the vav1 sh2 domain complexed with a syk-derived singly phosphorylated peptide
Chen, C. , Geahlen, R.L. , Gorenstein, N.M. , Piraner, D. , Post, C.B.
Primary Citation of Related Structures: 2MC1
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Proto-oncogene vav | A | 107 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GHMQDLSVHLWYAGPMERAGAESILANRSDGTFLVRQRVKDAAEFAISIKYNVEVKHIKIMTAEGLYRITEKKAFRGLTELVEFYQQNSLKDCFKSLDTTLQFPFKE |
| Tyrosine-protein kinase SYK | B | 13 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | DTEVYESPYADPE |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2013-08-13 Deposition Author(s): Chen, C. , Geahlen, R.L. , Gorenstein, N.M. , Piraner, D. , Post, C.B.