Nmr structure of the complete internal fusion loop mutant i544a from ebolavirus gp2 at ph 5.5
PDB DOI: 10.2210/pdb2mb1/pdb
Classification: VIRAL PROTEIN Organism(s): Adeno-Associated Virus 5
Deposited: 2013-07-22 Deposition Author(s): Gregory, S.M. , Tamm, L.K.
Method: SOLUTION NMR Resolution: N.A.
Nmr structure of the complete internal fusion loop mutant i544a from ebolavirus gp2 at ph 5.5
Primary Citation of Related Structures: 2MB1
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Virion spike glycoprotein | A | 54 | Adeno-Associated Virus 5 | AQPKCNPNLHYWTTQDEGAAIGLAWIPYFGPAAEGIYAEGLMHNQDGLICGLRQ |
Method: SOLUTION NMR
Deposited Date: 2013-07-22 Deposition Author(s): Gregory, S.M. , Tamm, L.K.