2M9I
Nmr solution structure of pin1 ww domain variant 6-1
PDB DOI: 10.2210/pdb2m9i/pdb
Classification: ISOMERASE Organism(s): N.A.
Deposited: 2013-06-10 Deposition Author(s): Chen, W. , Dyson, H.J. , Enck, S. , Kelly, J.W. , Powers, E.T. , Price, J.L. , Wong, C.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Nmr solution structure of pin1 ww domain variant 6-1
Chen, W. , Dyson, H.J. , Enck, S. , Kelly, J.W. , Powers, E.T. , Price, J.L. , Wong, C.
Primary Citation of Related Structures: 2M9I
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 | A | 34 | N.A. | KLPPGWEKRMFRSNGTVYYFNHITNASQFERPSG |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2013-06-10 Deposition Author(s): Chen, W. , Dyson, H.J. , Enck, S. , Kelly, J.W. , Powers, E.T. , Price, J.L. , Wong, C.