2M99
Solution structure of a chymotrypsin inhibitor from the taiwan cobra
PDB DOI: 10.2210/pdb2m99/pdb
Classification: HYDROLASE INHIBITOR Organism(s): Escherichia Coli O45:K1 (Strain S88 / Expec)
Deposited: 2013-06-05 Deposition Author(s): Chang, L.-S. , Guntert, P. , Ikeya, T. , Lin, Y.-J.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Solution structure of a chymotrypsin inhibitor from the taiwan cobra
Chang, L.-S. , Guntert, P. , Ikeya, T. , Lin, Y.-J.
Primary Citation of Related Structures: 2M99
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Protease inhibitor NACI | A | 57 | Escherichia Coli O45:K1 (Strain S88 / Expec) | RPRFCELAPSAGSCFAFVPSYYYNQYSNTCHSFTYSGCGGNANRFRTIDECNRTCVG |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2013-06-05 Deposition Author(s): Chang, L.-S. , Guntert, P. , Ikeya, T. , Lin, Y.-J.