Rxfp1 utilises hydrophobic moieties on a signalling surface of the ldla module to mediate receptor activation
PDB DOI: 10.2210/pdb2m7p/pdb
Classification: PROTEIN BINDING Organism(s): Salmonella Enterica
Deposited: 2013-04-29 Deposition Author(s): Bathgate, R.A.D. , Gooley, P.R. , Kong, R.Ck. , Lee, J.C.Y. , Ling, J. , Mohanty, B. , Petrie, E.J.
Rxfp1 utilises hydrophobic moieties on a signalling surface of the ldla module to mediate receptor activation
Bathgate, R.A.D. , Gooley, P.R. , Kong, R.Ck. , Lee, J.C.Y. , Ling, J. , Mohanty, B. , Petrie, E.J.
Primary Citation of Related Structures: 2M7P
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Low-density lipoprotein receptor, Relaxin receptor 1 | A | 42 | Salmonella Enterica | GSQDVTCSLGYFPCGNITKCIPQFWRCDGQVDCDNGSDEQGC |
Method: SOLUTION NMR
Deposited Date: 2013-04-29 Deposition Author(s): Bathgate, R.A.D. , Gooley, P.R. , Kong, R.Ck. , Lee, J.C.Y. , Ling, J. , Mohanty, B. , Petrie, E.J.