The actinobacterial transcription factor rbpa binds to the principal sigma subunit of rna polymerase
PDB DOI: 10.2210/pdb2m6p/pdb
Classification: TRANSCRIPTION Organism(s): Mycobacterium Bovis
Deposited: 2013-04-06 Deposition Author(s): Liu, B. , Matthews, S. , Paget, M. , Parsy, M.
Method: SOLUTION NMR Resolution: N.A.
The actinobacterial transcription factor rbpa binds to the principal sigma subunit of rna polymerase
Liu, B. , Matthews, S. , Paget, M. , Parsy, M.
Primary Citation of Related Structures: 2M6P
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| uncharacterized protein Mb2076 | A | 46 | Mycobacterium Bovis | PRQIARYRTDNGEEFEVPFADDAEIPGTWLCRNGMEGTLIEGDLPE |
Method: SOLUTION NMR
Deposited Date: 2013-04-06 Deposition Author(s): Liu, B. , Matthews, S. , Paget, M. , Parsy, M.