Analysis of the structural and molecular basis of voltage-sensitive sodium channel inhibition by the spider toxin, huwentoxin-iv (-trtx-hh2a).
PDB DOI: 10.2210/pdb2m50/pdb
Classification: TOXIN Organism(s): Brassicaceae
Deposited: 2013-02-12 Deposition Author(s): Flinspach, M. , Gibbs, A. , Minassian, N. , Wickenden, A.
Analysis of the structural and molecular basis of voltage-sensitive sodium channel inhibition by the spider toxin, huwentoxin-iv (-trtx-hh2a).
Flinspach, M. , Gibbs, A. , Minassian, N. , Wickenden, A.
Primary Citation of Related Structures: 2M50
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Mu-theraphotoxin-Hh2a | A | 35 | Brassicaceae | ECLEIFKACNPSNDQCCKSSKLVCSRKTRWCAYQI |
Method: SOLUTION NMR
Deposited Date: 2013-02-12 Deposition Author(s): Flinspach, M. , Gibbs, A. , Minassian, N. , Wickenden, A.