Analysis of the structural and molecular basis of voltage-sensitive sodium channel inhibition by the spider toxin, huwentoxin-iv (-trtx-hh2a).
PDB DOI: 10.2210/pdb2m4x/pdb
Classification: TOXIN Organism(s): Haplopelma Schmidti
Deposited: 2013-02-11 Deposition Author(s): Flinspach, M. , Gibbs, A.
Analysis of the structural and molecular basis of voltage-sensitive sodium channel inhibition by the spider toxin, huwentoxin-iv (-trtx-hh2a).
Primary Citation of Related Structures: 2M4X
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Mu-theraphotoxin-Hh2a | A | 35 | Haplopelma Schmidti | ECLEIFKACNPSNDQCCKSSKLVCSRKTRWCKYQI |
Method: SOLUTION NMR
Deposited Date: 2013-02-11 Deposition Author(s): Flinspach, M. , Gibbs, A.