Solution-state nmr structure of cataract-related human gamma(s)-crystallin point variant g18v
PDB DOI: 10.2210/pdb2m3u/pdb
Classification: STRUCTURAL PROTEIN Organism(s): Homo Sapiens
Deposited: 2013-01-25 Deposition Author(s): Brubaker, W.D. , Martin, R.W.
Solution-state nmr structure of cataract-related human gamma(s)-crystallin point variant g18v
Primary Citation of Related Structures: 2M3U
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Beta-crystallin S | A | 178 | Homo Sapiens | GSKTGTKITFYEDKNFQVRRYDCDCDCADFHTYLSRCNSIKVEGGTWAVYERPNFAGYMYILPQGEYPEYQRWMGLNDRLSSCRAVHLPSGGQYKIQIFEKGDFSGQMYETTEDCPSIMEQFHMREIHSCKVLEGVWIFYELPNYRGRQYLLDKKEYRKPIDWGAASPAVQSFRRIVE |
Method: SOLUTION NMR
Deposited Date: 2013-01-25 Deposition Author(s): Brubaker, W.D. , Martin, R.W.