2M36
Solution structure of the insecticidal spider-venom peptide aps iii
PDB DOI: 10.2210/pdb2m36/pdb
Classification: TOXIN Organism(s): Apomastus Schlingeri
Deposited: 2013-01-10 Deposition Author(s): Bende, N.S. , King, G.F. , Mobli, M.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Solution structure of the insecticidal spider-venom peptide aps iii
Bende, N.S. , King, G.F. , Mobli, M.
Primary Citation of Related Structures: 2M36
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| U2-cyrtautoxin-As1a | A | 38 | Apomastus Schlingeri | SCNSKGTPCTNADECCGGKCAYNVWNCIGGGCSKTCGY |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2013-01-10 Deposition Author(s): Bende, N.S. , King, G.F. , Mobli, M.