Solution nmr structure of cyclin-dependent kinase 2-associated protein 2 (cdk2ap2, doc-1r) from homo sapiens, northeast structural genomics consortium (nesg) target hr8910c
PDB DOI: 10.2210/pdb2m1l/pdb
Classification: CELL CYCLE Organism(s): Homo Sapiens
Deposited: 2012-11-30 Deposition Author(s): Ertekin, A. , Janjua, H. , Kohan, E. , Montelione, G.T. , Northeast Structural Genomics Consortium (Nesg) , Pederson, K. , Prestegard, J.H. , Shastry, R.
Solution nmr structure of cyclin-dependent kinase 2-associated protein 2 (cdk2ap2, doc-1r) from homo sapiens, northeast structural genomics consortium (nesg) target hr8910c
Ertekin, A. , Janjua, H. , Kohan, E. , Montelione, G.T. , Northeast Structural Genomics Consortium (Nesg) , Pederson, K. , Prestegard, J.H. , Shastry, R.
Primary Citation of Related Structures: 2M1L
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Cyclin-dependent kinase 2-associated protein 2 | A | 69 | Homo Sapiens | SHMAMKPPGAQGSQSTYTDLLSVIEEMGKEIRPTYAGSKSAMERLKRGIIHARALVRECLAETERNART |
| Cyclin-dependent kinase 2-associated protein 2 | B | 69 | Homo Sapiens | SHMAMKPPGAQGSQSTYTDLLSVIEEMGKEIRPTYAGSKSAMERLKRGIIHARALVRECLAETERNART |
Method: SOLUTION NMR
Deposited Date: 2012-11-30 Deposition Author(s): Ertekin, A. , Janjua, H. , Kohan, E. , Montelione, G.T. , Northeast Structural Genomics Consortium (Nesg) , Pederson, K. , Prestegard, J.H. , Shastry, R.