Haddock structure of gtyybt pas homodimer
PDB DOI: 10.2210/pdb2m1c/pdb
Classification: HYDROLASE Organism(s): Geobacillus Thermodenitrificans
Deposited: 2012-11-25 Deposition Author(s): Lescar, J. , Liang, Z.X. , Pasunooti, S. , Pervushin, K. , Rao, F. , Soehano, I. , Tan, E.
Haddock structure of gtyybt pas homodimer
Lescar, J. , Liang, Z.X. , Pasunooti, S. , Pervushin, K. , Rao, F. , Soehano, I. , Tan, E.
Primary Citation of Related Structures: 2M1C
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| DHH subfamily 1 protein | A | 113 | Geobacillus Thermodenitrificans | RGSHMRSLHKELQQYISNLSYRVKKVSEEALMQMPIGILLLDEEDKIEWSNRFLAACFKEQTLIGRSLAELSEPLAAFVKKGKTDEEIIELNGKQLKVIVHRHERLLYFFDVT |
| DHH subfamily 1 protein | B | 113 | Geobacillus Thermodenitrificans | RGSHMRSLHKELQQYISNLSYRVKKVSEEALMQMPIGILLLDEEDKIEWSNRFLAACFKEQTLIGRSLAELSEPLAAFVKKGKTDEEIIELNGKQLKVIVHRHERLLYFFDVT |
Method: SOLUTION NMR
Deposited Date: 2012-11-25 Deposition Author(s): Lescar, J. , Liang, Z.X. , Pasunooti, S. , Pervushin, K. , Rao, F. , Soehano, I. , Tan, E.