Nmr structure of the complex between the ph domain of the tfb1 subunit from tfiih and rad4
PDB DOI: 10.2210/pdb2m14/pdb
Classification: TRANSCRIPTION/DNA BINDING PROTEIN Organism(s): Saccharomyces Cerevisiae
Deposited: 2012-11-16 Deposition Author(s): Arseneault, G. , Cappadocia, L. , Lafrance-Vanasse, J. , Legault, P. , Omichinski, J.G.
Nmr structure of the complex between the ph domain of the tfb1 subunit from tfiih and rad4
Arseneault, G. , Cappadocia, L. , Lafrance-Vanasse, J. , Legault, P. , Omichinski, J.G.
Primary Citation of Related Structures: 2M14
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| RNA polymerase II transcription factor B subunit 1 | A | 119 | Saccharomyces Cerevisiae | PSHSGAAIFEKVSGIIAINEDVSPAELTWRSTDGDKVHTVVLSTIDKLQATPASSEKMMLRLIGKVDESKKRKDNEGNEVVPKPQRHMFSFNNRTVMDNIKMTLQQIISRYKDADGNSS |
| DNA repair protein RAD4 | B | 42 | Saccharomyces Cerevisiae | GSTDDSVEEIQSSEEDYDSEEFEDVTDGNEVAGVEDISVEIK |
Method: SOLUTION NMR
Deposited Date: 2012-11-16 Deposition Author(s): Arseneault, G. , Cappadocia, L. , Lafrance-Vanasse, J. , Legault, P. , Omichinski, J.G.