2M0V
Complex structure of c-terminal cftr peptide and extended pdz2 domain from nherf1
PDB DOI: 10.2210/pdb2m0v/pdb
Classification: PROTEIN BINDING/PROTEIN BINDING Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2012-11-06 Deposition Author(s): Bhattacharya, S. , Bu, Z. , Cowburn, D. , Ju, J.H.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Complex structure of c-terminal cftr peptide and extended pdz2 domain from nherf1
Bhattacharya, S. , Bu, Z. , Cowburn, D. , Ju, J.H.
Primary Citation of Related Structures: 2M0V
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Na(+)/H(+) exchange regulatory cofactor NHE-RF1 | A | 128 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GIDPFTMLRPRLCTMKKGPSGYGFNLHSDKSKPGQFIRSVDPDSPAEASGLRAQDRIVEVNGVCMEGKQHGDVVSAIRAGGDETKLLVVDRETDEFFKKCRVIPSQEHLNGPLPVPFTNGEIQKENSR |
| C-terminal CFTR peptide | B | 5 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | QDTRL |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2012-11-06 Deposition Author(s): Bhattacharya, S. , Bu, Z. , Cowburn, D. , Ju, J.H.