Solution structure of the tenth complement type repeat of human megalin
PDB DOI: 10.2210/pdb2m0p/pdb
Classification: LIPID BINDING PROTEIN Organism(s): Homo Sapiens
Deposited: 2012-11-01 Deposition Author(s): Dagil, R. , Kragelund, B.
Method: SOLUTION NMR Resolution: N.A.
Solution structure of the tenth complement type repeat of human megalin
Primary Citation of Related Structures: 2M0P
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Low-density lipoprotein receptor-related protein 2 | A | 52 | Homo Sapiens | THAPASCLDTQYTCDNHQCISKNWVCDTDNDCGDGSDEKNCNSTETHHHHHH |
Method: SOLUTION NMR
Deposited Date: 2012-11-01 Deposition Author(s): Dagil, R. , Kragelund, B.