Homodimeric transmembrane domain of the human receptor tyrosine kinase erbb1 (egfr, her1) in micelles
PDB DOI: 10.2210/pdb2m0b/pdb
Classification: MEMBRANE PROTEIN Organism(s): Salmonella Enterica
Deposited: 2012-10-24 Deposition Author(s): Arseniev, A.S. , Bocharov, E.V. , Bocharova, O.V. , Lesovoy, D.M. , Pustovalova, Y.E.
Homodimeric transmembrane domain of the human receptor tyrosine kinase erbb1 (egfr, her1) in micelles
Arseniev, A.S. , Bocharov, E.V. , Bocharova, O.V. , Lesovoy, D.M. , Pustovalova, Y.E.
Primary Citation of Related Structures: 2M0B
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Epidermal growth factor receptor | A | 44 | Salmonella Enterica | EGCPTNGPKIPSIATGMVGALLLLLVVALGIGLFMRRRHIVRKR |
Epidermal growth factor receptor | B | 44 | Salmonella Enterica | EGCPTNGPKIPSIATGMVGALLLLLVVALGIGLFMRRRHIVRKR |
Method: SOLUTION NMR
Deposited Date: 2012-10-24 Deposition Author(s): Arseniev, A.S. , Bocharov, E.V. , Bocharova, O.V. , Lesovoy, D.M. , Pustovalova, Y.E.