Refined solution structure of recombinant brazzein at low temperature
PDB DOI: 10.2210/pdb2ly6/pdb
Classification: PLANT PROTEIN Organism(s): Pentadiplandra Brazzeana
Deposited: 2012-09-12 Deposition Author(s): Assadi-Porter, F.M. , Cornilescu, C.C. , Cornilescu, G. , Markley, J.L. , Tonelli, M.
Method: SOLUTION NMR Resolution: N.A.
Refined solution structure of recombinant brazzein at low temperature
Assadi-Porter, F.M. , Cornilescu, C.C. , Cornilescu, G. , Markley, J.L. , Tonelli, M.
Primary Citation of Related Structures: 2LY6
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Defensin-like protein | A | 53 | Pentadiplandra Brazzeana | DKCKKVYENYPVSKCQLANQCNYDCKLDKHARSGECFYDEKRNLQCICDYCEY |
Method: SOLUTION NMR
Deposited Date: 2012-09-12 Deposition Author(s): Assadi-Porter, F.M. , Cornilescu, C.C. , Cornilescu, G. , Markley, J.L. , Tonelli, M.