Arced helix (arch) nmr structure of the reovirus p14 fusion-associated small transmembrane (fast) protein transmembrane domain (tmd) in dodecyl phosphocholine (dpc) micelles
PDB DOI: 10.2210/pdb2lx0/pdb
Classification: MEMBRANE PROTEIN Organism(s): N.A.
Deposited: 2012-08-10 Deposition Author(s): Duncan, R. , Key, T. , Rainey, J.K. , Sarker, M.
Method: SOLUTION NMR Resolution: N.A.
Arced helix (arch) nmr structure of the reovirus p14 fusion-associated small transmembrane (fast) protein transmembrane domain (tmd) in dodecyl phosphocholine (dpc) micelles
Duncan, R. , Key, T. , Rainey, J.K. , Sarker, M.
Primary Citation of Related Structures: 2LX0
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Membrane fusion protein p14 | A | 32 | N.A. | KKHTIWEVIAGLVALLTFLAFGFWLFKYLQKK |
Method: SOLUTION NMR
Deposited Date: 2012-08-10 Deposition Author(s): Duncan, R. , Key, T. , Rainey, J.K. , Sarker, M.