Solution structure of the zinc finger afv1p06 protein from the hyperthermophilic archaeal virus afv1
PDB DOI: 10.2210/pdb2lvh/pdb
Classification: METAL BINDING PROTEIN Organism(s): Acidianus Filamentous Virus 1
Deposited: 2012-07-05 Deposition Author(s): Delepierre, M. , Guijarro, J. , Guilliere, F. , Prangishvili, D. , Sezonov, G.
Solution structure of the zinc finger afv1p06 protein from the hyperthermophilic archaeal virus afv1
Delepierre, M. , Guijarro, J. , Guilliere, F. , Prangishvili, D. , Sezonov, G.
Primary Citation of Related Structures: 2LVH
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Putative zinc finger protein ORF59a | A | 59 | Acidianus Filamentous Virus 1 | MIEVSSMERVYQCLRCGLTFRTKKQLIRHLVNTEKVNPLSIDYYYQSFSVSLKDVNKII |
Method: SOLUTION NMR
Deposited Date: 2012-07-05 Deposition Author(s): Delepierre, M. , Guijarro, J. , Guilliere, F. , Prangishvili, D. , Sezonov, G.