Solution structure of ca2+-bound cabp7 n-terminal doman
PDB DOI: 10.2210/pdb2lv7/pdb
Classification: METAL BINDING PROTEIN Organism(s): Homo Sapiens
Deposited: 2012-06-29 Deposition Author(s): Burgoyne, R.D. , Haynes, L.P. , Herbert, A.P. , Lian, L. , Mccue, H.V. , Patel, P.
Solution structure of ca2+-bound cabp7 n-terminal doman
Burgoyne, R.D. , Haynes, L.P. , Herbert, A.P. , Lian, L. , Mccue, H.V. , Patel, P.
Primary Citation of Related Structures: 2LV7
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Calcium-binding protein 7 | A | 100 | Homo Sapiens | MPFHPVTAALMYRGIYTVPNLLSEQRPVDIPEDELEEIREAFKVFDRDGNGFISKQELGTAMRSLGYMPNEVELEVIIQRLDMDGDGQVDFEEFVTLLGP |
Method: SOLUTION NMR
Deposited Date: 2012-06-29 Deposition Author(s): Burgoyne, R.D. , Haynes, L.P. , Herbert, A.P. , Lian, L. , Mccue, H.V. , Patel, P.