2LUM
Three-state ensemble obtained from enoes of the third immunoglobulin binding domain of protein g (gb3)
PDB DOI: 10.2210/pdb2lum/pdb
Classification: PROTEIN BINDING Organism(s): Streptococcus Sp. 'Group G'
Deposited: 2012-06-18 Deposition Author(s): Guntert, P. , Kazemi, S. , Riek, R. , Vogeli, B.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Three-state ensemble obtained from enoes of the third immunoglobulin binding domain of protein g (gb3)
Guntert, P. , Kazemi, S. , Riek, R. , Vogeli, B.
Primary Citation of Related Structures: 2LUM
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Immunoglobulin G-binding protein G | A | 56 | Streptococcus Sp. 'Group G' | MQYKLVINGKTLKGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTE |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2012-06-18 Deposition Author(s): Guntert, P. , Kazemi, S. , Riek, R. , Vogeli, B.