Nmr solution structure of recombinant tamapin
PDB DOI: 10.2210/pdb2lu9/pdb
Classification: TOXIN Organism(s): Mesobuthus Tamulus
Deposited: 2012-06-08 Deposition Author(s): Del Rio-Portilla, F. , Ramirez-Cordero, B.
Method: SOLUTION NMR Resolution: N.A.
Nmr solution structure of recombinant tamapin
Del Rio-Portilla, F. , Ramirez-Cordero, B.
Primary Citation of Related Structures: 2LU9
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Potassium channel toxin alpha-KTx 5.4 | A | 31 | Mesobuthus Tamulus | AFCNLRRCELSCRSLGLLGKCIGEECKCVPY |
Method: SOLUTION NMR
Deposited Date: 2012-06-08 Deposition Author(s): Del Rio-Portilla, F. , Ramirez-Cordero, B.