2LTV
Yap ww2 in complex with a smad7 derived peptide
PDB DOI: 10.2210/pdb2ltv/pdb
Classification: PROTEIN BINDING/PEPTIDE Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2012-06-04 Deposition Author(s): Aragon, E. , Gao, S. , Goerner, N. , Lopes, T. , Macias, M.J. , Massague, J. , Xi, Q.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Yap ww2 in complex with a smad7 derived peptide
Aragon, E. , Gao, S. , Goerner, N. , Lopes, T. , Macias, M.J. , Massague, J. , Xi, Q.
Primary Citation of Related Structures: 2LTV
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Yorkie homolog | A | 36 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDP |
| Smad7 derived peptide | B | 12 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | SPPPPYSRYPMD |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2012-06-04 Deposition Author(s): Aragon, E. , Gao, S. , Goerner, N. , Lopes, T. , Macias, M.J. , Massague, J. , Xi, Q.