2LTT
Solution nmr structure of ydbc:dt19g1 complex. northeast structural genomics consortium (nesg) target kr150
PDB DOI: 10.2210/pdb2ltt/pdb
Classification: TRANSCRIPTION, DNA BINDING PROTEIN/DNA Organism(s): Lactococcus Lactis Subsp. Lactis , Synthetic Construct
Deposited: 2012-05-31 Deposition Author(s): Acton, T.B. , Aramini, J.A. , Barbieri, C.M. , Bini, E. , Ciccosanti, C. , Everett, J.K. , Janjua, H. , Lee, H. , Montelione, G.T. , Northeast Structural Genomics Consortium (Nesg) , Rossi, P. , Wang, H. , Xiao, R.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Solution nmr structure of ydbc:dt19g1 complex. northeast structural genomics consortium (nesg) target kr150
Acton, T.B. , Aramini, J.A. , Barbieri, C.M. , Bini, E. , Ciccosanti, C. , Everett, J.K. , Janjua, H. , Lee, H. , Montelione, G.T. , Northeast Structural Genomics Consortium (Nesg) , Rossi, P. , Wang, H. , Xiao, R.
Primary Citation of Related Structures: 2LTT
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Putative uncharacterized protein ydbC | A | 80 | Lactococcus Lactis Subsp. Lactis , Synthetic Construct | MADKLKFEIIEELIVLSENAKGWRKELNRVSWNDAEPKYDIRTWSPDHEKMGKGITLSEEEFGVLLKELGNKLEHHHHHH |
| Putative uncharacterized protein ydbC | B | 80 | Lactococcus Lactis Subsp. Lactis , Synthetic Construct | MADKLKFEIIEELIVLSENAKGWRKELNRVSWNDAEPKYDIRTWSPDHEKMGKGITLSEEEFGVLLKELGNKLEHHHHHH |
| Nucleic Acids / Hybrid | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| DNA (5'-D(*TP*TP*TP*TP*TP*TP*TP*TP*TP*TP*TP*TP*TP*TP*TP*TP*T)-3') | c | 17 | NA | TTTTTTTTTTTTTTTTT |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2012-05-31 Deposition Author(s): Acton, T.B. , Aramini, J.A. , Barbieri, C.M. , Bini, E. , Ciccosanti, C. , Everett, J.K. , Janjua, H. , Lee, H. , Montelione, G.T. , Northeast Structural Genomics Consortium (Nesg) , Rossi, P. , Wang, H. , Xiao, R.