Solution structure of the sant2 domain of the human nuclear receptor corepressor 2 (ncor2), northeast structural genomics consortium (nesg) target id hr4636e
PDB DOI: 10.2210/pdb2ltp/pdb
Classification: Transcription regulator Organism(s): Homo Sapiens
Deposited: 2012-05-30 Deposition Author(s): Arrowsmith, C. , Bellanda, M. , Garcia, M. , Houliston, S. , Lemak, A. , Min, J. , Montecchio, M. , Montelione, G.T. , Northeast Structural Genomics Consortium (Nesg) , Structural Genomics Consortium (Sgc) , Xu, C. , Yee, A.
Solution structure of the sant2 domain of the human nuclear receptor corepressor 2 (ncor2), northeast structural genomics consortium (nesg) target id hr4636e
Arrowsmith, C. , Bellanda, M. , Garcia, M. , Houliston, S. , Lemak, A. , Min, J. , Montecchio, M. , Montelione, G.T. , Northeast Structural Genomics Consortium (Nesg) , Structural Genomics Consortium (Sgc) , Xu, C. , Yee, A.
Primary Citation of Related Structures: 2LTP
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Nuclear receptor corepressor 2 | A | 89 | Homo Sapiens | MHHHHHHSSGRENLYFQGWTEEEMGTAKKGLLEHGRNWSAIARMVGSKTVSQCKNFYFNYKKRQNLDEILQQHKLKMEKERNARRKKKK |
Method: SOLUTION NMR
Deposited Date: 2012-05-30 Deposition Author(s): Arrowsmith, C. , Bellanda, M. , Garcia, M. , Houliston, S. , Lemak, A. , Min, J. , Montecchio, M. , Montelione, G.T. , Northeast Structural Genomics Consortium (Nesg) , Structural Genomics Consortium (Sgc) , Xu, C. , Yee, A.