Solution structure of a monomeric truncated mutant of trypanosoma brucei 1-c-grx1
PDB DOI: 10.2210/pdb2ltk/pdb
Classification: OXIDOREDUCTASE Organism(s): Trypanosoma Brucei
Deposited: 2012-05-29 Deposition Author(s): Bellanda, M. , Comini, M. , Gesiot, L. , Mammi, S. , Manta, B. , Pavan, C. , Sturlese, M.
Method: SOLUTION NMR Resolution: N.A.
Solution structure of a monomeric truncated mutant of trypanosoma brucei 1-c-grx1
Bellanda, M. , Comini, M. , Gesiot, L. , Mammi, S. , Manta, B. , Pavan, C. , Sturlese, M.
Primary Citation of Related Structures: 2LTK
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Mono-cysteine glutaredoxin | A | 110 | Trypanosoma Brucei | GAMVKKDIDDTIKSEDVVTFIKGLPEAPMCAYSKRMIDVLEALGLEYTSFDVLAHPVVRSYVKEVSEWPTIPQLFIKAEFVGGLDIVTKMLESGDLKKMLRDKGITCRDL |
Method: SOLUTION NMR
Deposited Date: 2012-05-29 Deposition Author(s): Bellanda, M. , Comini, M. , Gesiot, L. , Mammi, S. , Manta, B. , Pavan, C. , Sturlese, M.