2LST
Solution structure of a thioredoxin from thermus thermophilus
PDB DOI: 10.2210/pdb2lst/pdb
Classification: OXIDOREDUCTASE Organism(s): Thermus Thermophilus
Deposited: 2012-05-04 Deposition Author(s): Almo, S.C. , Bandaranayake, A.D. , Banu, R. , Bonanno, J.B. , Calarese, D.A. , Celikgil, A. , Chamala, S. , Chan, M.K. , Chaparro, R. , Evans, B. , Garforth, S. , Girvin, M.E. , Gizzi, A. , Harris, R. , Hillerich, B. , Kar, A. , Lafleur, J. , Lim, S. , Love, J. , Matikainen, B. , New York Structural Genomics Research Consortium (Nysgrc) , Patel, H. , Seidel, R.D. , Smith, B. , Stead, M.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Solution structure of a thioredoxin from thermus thermophilus
Almo, S.C. , Bandaranayake, A.D. , Banu, R. , Bonanno, J.B. , Calarese, D.A. , Celikgil, A. , Chamala, S. , Chan, M.K. , Chaparro, R. , Evans, B. , Garforth, S. , Girvin, M.E. , Gizzi, A. , Harris, R. , Hillerich, B. , Kar, A. , Lafleur, J. , Lim, S. , Love, J. , Matikainen, B. , New York Structural Genomics Research Consortium (Nysgrc) , Patel, H. , Seidel, R.D. , Smith, B. , Stead, M.
Primary Citation of Related Structures: 2LST
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Thioredoxin | A | 130 | Thermus Thermophilus | MSLRWYPYPEALALAQAHGRMVMVYFHSEHCPYCQQMNTFVLSDPGVSRLLEARFVVASVSVDTPEGQELARRYRVPGTPTFVFLVPKAGAWEEVGRLFGSRPRAEFLKELRQVCVKGGACGEGHHHHHH |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2012-05-04 Deposition Author(s): Almo, S.C. , Bandaranayake, A.D. , Banu, R. , Bonanno, J.B. , Calarese, D.A. , Celikgil, A. , Chamala, S. , Chan, M.K. , Chaparro, R. , Evans, B. , Garforth, S. , Girvin, M.E. , Gizzi, A. , Harris, R. , Hillerich, B. , Kar, A. , Lafleur, J. , Lim, S. , Love, J. , Matikainen, B. , New York Structural Genomics Research Consortium (Nysgrc) , Patel, H. , Seidel, R.D. , Smith, B. , Stead, M.