Solution structure of the r3h domain from human smubp-2 in complex with 2'-deoxyguanosine-5'-monophosphate
PDB DOI: 10.2210/pdb2lrr/pdb
Classification: HYDROLASE Organism(s): Homo Sapiens
Deposited: 2012-04-12 Deposition Author(s): Jaudzems, K. , Liepinsh, E. , Otting, G. , Zhulenkovs, D.
Solution structure of the r3h domain from human smubp-2 in complex with 2'-deoxyguanosine-5'-monophosphate
Jaudzems, K. , Liepinsh, E. , Otting, G. , Zhulenkovs, D.
Primary Citation of Related Structures: 2LRR
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| DNA-binding protein SMUBP-2 | A | 86 | Homo Sapiens | MGSLNGGSPEGVESQDGVDHFRAMIVEFMASKKMQLEFPPSLNSHDRLRVHQIAEEHGLRHDSSGEGKRRFITVSKRAGSHHHHHH |
Method: SOLUTION NMR
Deposited Date: 2012-04-12 Deposition Author(s): Jaudzems, K. , Liepinsh, E. , Otting, G. , Zhulenkovs, D.