Nmr spatial structure of the trypsin inhibitor bwi-2c from the buckwheat seeds
PDB DOI: 10.2210/pdb2lqx/pdb
Classification: HYDROLASE INHIBITOR Organism(s): Fagopyrum Esculentum
Deposited: 2012-03-19 Deposition Author(s): Egorov, T.A. , Grishin, E.V. , Mineev, K.S. , Oparin, P.B. , Vassilevski, A.A.
Nmr spatial structure of the trypsin inhibitor bwi-2c from the buckwheat seeds
Egorov, T.A. , Grishin, E.V. , Mineev, K.S. , Oparin, P.B. , Vassilevski, A.A.
Primary Citation of Related Structures: 2LQX
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Trypsin inhibitor BWI-2c | A | 41 | Fagopyrum Esculentum | SEKPQQELEECQNVCRMKRWSTEMVHRCEKKCEEKFERQQR |
Method: SOLUTION NMR
Deposited Date: 2012-03-19 Deposition Author(s): Egorov, T.A. , Grishin, E.V. , Mineev, K.S. , Oparin, P.B. , Vassilevski, A.A.