Solution structure of de novo designed peptide 4m
PDB DOI: 10.2210/pdb2lq2/pdb
Classification: ANTIFREEZE PROTEIN Organism(s): N.A.
Deposited: 2012-02-22 Deposition Author(s): Bhunia, A.
Method: SOLUTION NMR Resolution: N.A.
Solution structure of de novo designed peptide 4m
Primary Citation of Related Structures: 2LQ2
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| de novo designed antifreeze peptide 4m | A | 30 | N.A. | VKGRIDAPDFPSSPAILGKAATDVVAAWKS |
Method: SOLUTION NMR
Deposited Date: 2012-02-22 Deposition Author(s): Bhunia, A.