R state structure of monomeric phospholamban (c36a, c41f, c46a)
PDB DOI: 10.2210/pdb2lpf/pdb
Classification: MEMBRANE PROTEIN Organism(s): Oryctolagus Cuniculus
Deposited: 2012-02-11 Deposition Author(s): De Simone, A. , Gustavsson, M. , Montalvao, R.W. , Shi, L. , Veglia, G. , Vendruscolo, M.
R state structure of monomeric phospholamban (c36a, c41f, c46a)
De Simone, A. , Gustavsson, M. , Montalvao, R.W. , Shi, L. , Veglia, G. , Vendruscolo, M.
Primary Citation of Related Structures: 2LPF
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Cardiac phospholamban | A | 53 | Oryctolagus Cuniculus | AMEKVQYLTRSAIRRASTIEMPQQARQNLQNLFINFALILIFLLLIAIIVMLL |
Method: SOLUTION NMR
Deposited Date: 2012-02-11 Deposition Author(s): De Simone, A. , Gustavsson, M. , Montalvao, R.W. , Shi, L. , Veglia, G. , Vendruscolo, M.