Structure of gp41-m-mat, a membrane associated mper trimer from hiv-1 gp41.
PDB DOI: 10.2210/pdb2lp7/pdb
Classification: VIRAL PROTEIN Organism(s): Human Immunodeficiency Virus 1
Deposited: 2012-02-03 Deposition Author(s): Reardon, P.N.
Structure of gp41-m-mat, a membrane associated mper trimer from hiv-1 gp41.
Primary Citation of Related Structures: 2LP7
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Envelope glycoprotein | A | 59 | Human Immunodeficiency Virus 1 | GYIPEAPRDGQAYVRKDGEWVLLSTFLGSSGNEQELLELDKWASLWNWFNITNWLWYIK |
| Envelope glycoprotein | B | 59 | Human Immunodeficiency Virus 1 | GYIPEAPRDGQAYVRKDGEWVLLSTFLGSSGNEQELLELDKWASLWNWFNITNWLWYIK |
| Envelope glycoprotein | C | 59 | Human Immunodeficiency Virus 1 | GYIPEAPRDGQAYVRKDGEWVLLSTFLGSSGNEQELLELDKWASLWNWFNITNWLWYIK |
Method: SOLUTION NMR
Deposited Date: 2012-02-03 Deposition Author(s): Reardon, P.N.