Solution structure of sgf73(59-102) zinc finger domain
PDB DOI: 10.2210/pdb2lo3/pdb
Classification: TRANSCRIPTION Organism(s): Saccharomyces Cerevisiae
Deposited: 2012-01-10 Deposition Author(s): Bonnet, J. , Devys, D. , Gao, X. , Kieffer, B. , Koehler, C.
Solution structure of sgf73(59-102) zinc finger domain
Bonnet, J. , Devys, D. , Gao, X. , Kieffer, B. , Koehler, C.
Primary Citation of Related Structures: 2LO3
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| SAGA-associated factor 73 | A | 44 | Saccharomyces Cerevisiae | NPNAQLIEDPLDKPIQYRVCEKCGKPLALTAIVDHLENHCAGAS |
Method: SOLUTION NMR
Deposited Date: 2012-01-10 Deposition Author(s): Bonnet, J. , Devys, D. , Gao, X. , Kieffer, B. , Koehler, C.