Enterohaemorrhagic e. coli (ehec) exploits a tryptophan switch to hijack host f-actin assembly
PDB DOI: 10.2210/pdb2lnh/pdb
Classification: Signaling Protein/Protein Binding Organism(s): Vaccinia Virus Ankara , Salmonella Enterica
Deposited: 2011-12-28 Deposition Author(s): Aitio, O. , Hellman, M. , Kesti, T. , Leong, J.M. , Permi, P. , Saksela, K. , Skehan, B.
Enterohaemorrhagic e. coli (ehec) exploits a tryptophan switch to hijack host f-actin assembly
Aitio, O. , Hellman, M. , Kesti, T. , Leong, J.M. , Permi, P. , Saksela, K. , Skehan, B.
Primary Citation of Related Structures: 2LNH
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Neural Wiskott-Aldrich syndrome protein | A | 65 | Vaccinia Virus Ankara , Salmonella Enterica | GSNFQHIGHVGWDPNTGFDLNNLDPELKNLFDMCGISEAQLKDRETSKVIYDFIEKTGGVEAVKN |
Brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 1 | B | 67 | Vaccinia Virus Ankara , Salmonella Enterica | GSHMKKQKVKTIFPHTAGSNKTLLSFAQGDVITLLIPEEKDGWLYGEHDVSKARGWFPSSYTKLLEE |
Secreted effector protein EspF(U) | C | 48 | Vaccinia Virus Ankara , Salmonella Enterica | GLPDVAQRLMQHLAEHGIQPARNMAEHIPPAPNWPAPTPPVQNEQSRP |
Method: SOLUTION NMR
Deposited Date: 2011-12-28 Deposition Author(s): Aitio, O. , Hellman, M. , Kesti, T. , Leong, J.M. , Permi, P. , Saksela, K. , Skehan, B.