Solution structure of mouse pheromone esp1
PDB DOI: 10.2210/pdb2lmk/pdb
Classification: SIGNALING PROTEIN Organism(s): Enterobacter Aerogenes
Deposited: 2011-12-06 Deposition Author(s): Esaki, K. , Haga-Yamanaka, S. , Hamaguchi, T. , Hirakane, M. , Kimoto, H. , Sato, T. , Shimada, I. , Terasawa, H. , Touhara, K. , Tsunoda, M. , Yoshinaga, S.
Solution structure of mouse pheromone esp1
Esaki, K. , Haga-Yamanaka, S. , Hamaguchi, T. , Hirakane, M. , Kimoto, H. , Sato, T. , Shimada, I. , Terasawa, H. , Touhara, K. , Tsunoda, M. , Yoshinaga, S.
Primary Citation of Related Structures: 2LMK
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Exocrine gland-secreting peptide 1 | A | 57 | Enterobacter Aerogenes | GSNPDPQEVQRALARILCALGELDKLVKDQANAGQQEFKLPKDFTGRSKCRSLGRIK |
Method: SOLUTION NMR
Deposited Date: 2011-12-06 Deposition Author(s): Esaki, K. , Haga-Yamanaka, S. , Hamaguchi, T. , Hirakane, M. , Kimoto, H. , Sato, T. , Shimada, I. , Terasawa, H. , Touhara, K. , Tsunoda, M. , Yoshinaga, S.