Nmr structure of the c-terminal domain of vp7 in membrane mimicking micelles
PDB DOI: 10.2210/pdb2lm7/pdb
Classification: VIRAL PROTEIN Organism(s): Lactiplantibacillus Plantarum Subsp. Plantarum Nc8
Deposited: 2011-11-23 Deposition Author(s): Bouaziz, S. , Elaid, S. , Lepault, J. , Libersou, S. , Morellet, N. , Ouldali, M.
Method: SOLUTION NMR Resolution: N.A.
Nmr structure of the c-terminal domain of vp7 in membrane mimicking micelles
Bouaziz, S. , Elaid, S. , Lepault, J. , Libersou, S. , Morellet, N. , Ouldali, M.
Primary Citation of Related Structures: 2LM7
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Outer capsid glycoprotein VP7 | A | 61 | Lactiplantibacillus Plantarum Subsp. Plantarum Nc8 | SDVLDITADPTTAPQTERMMRINWKKWWQVFYTVVDYVNQIIQLMSKRSRSLNSAAFYYRV |
Method: SOLUTION NMR
Deposited Date: 2011-11-23 Deposition Author(s): Bouaziz, S. , Elaid, S. , Lepault, J. , Libersou, S. , Morellet, N. , Ouldali, M.