Nmr structure of the protein np_814968.1 from enterococcus faecalis
PDB DOI: 10.2210/pdb2llg/pdb
Classification: STRUCTURAL GENOMICS, UNKNOWN FUNCTION Organism(s): Enterococcus Faecalis
Deposited: 2011-11-08 Deposition Author(s): Geralt, M. , Joint Center For Structural Genomics (Jcsg) , Mohanty, B. , Serrano, P. , Susac, L. , Wuthrich, K.
Nmr structure of the protein np_814968.1 from enterococcus faecalis
Geralt, M. , Joint Center For Structural Genomics (Jcsg) , Mohanty, B. , Serrano, P. , Susac, L. , Wuthrich, K.
Primary Citation of Related Structures: 2LLG
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Uncharacterized protein | A | 143 | Enterococcus Faecalis | MDEVLATSIGTYENRTLLVPDGRLALTALHKGKDYQGKPMFYVLFELTNTTEKTQNIQLMIQSFMEVSQTVHGKAQNLQYAVLTDSPFQDKLDRLADEINPGETIQGAYPYEFINENKPVHFKFRDRLLSLDEPIASEEITIT |
Method: SOLUTION NMR
Deposited Date: 2011-11-08 Deposition Author(s): Geralt, M. , Joint Center For Structural Genomics (Jcsg) , Mohanty, B. , Serrano, P. , Susac, L. , Wuthrich, K.