Nmr determination of the global structure of the cd-113 derivative of desulforedoxin
PDB DOI: 10.2210/pdb2lk6/pdb
Classification: ELECTRON TRANSPORT Organism(s): Leuconostoc Mesenteroides Subsp. Sake
Deposited: 2011-10-07 Deposition Author(s): Domke, T. , Goodfellow, B.J. , Moura, I. , Moura, J.J.G. , Rusnak, F.
Nmr determination of the global structure of the cd-113 derivative of desulforedoxin
Domke, T. , Goodfellow, B.J. , Moura, I. , Moura, J.J.G. , Rusnak, F.
Primary Citation of Related Structures: 2LK6
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Desulforedoxin | A | 36 | Leuconostoc Mesenteroides Subsp. Sake | ANEGDVYKCELCGQVVKVLEEGGGTLVCCGEDMVKQ |
Desulforedoxin | B | 36 | Leuconostoc Mesenteroides Subsp. Sake | ANEGDVYKCELCGQVVKVLEEGGGTLVCCGEDMVKQ |
Method: SOLUTION NMR
Deposited Date: 2011-10-07 Deposition Author(s): Domke, T. , Goodfellow, B.J. , Moura, I. , Moura, J.J.G. , Rusnak, F.