Structure of the influenza am2-bm2 chimeric channel bound to rimantadine
PDB DOI: 10.2210/pdb2ljc/pdb
Classification: Transport protein/Inhibitor Organism(s): Influenza A Virus, Influenza B Virus
Deposited: 2011-09-10 Deposition Author(s): Chou, J.J. , Oxenoid, K. , Pielak, R.M.
Method: SOLUTION NMR Resolution: N.A.
Structure of the influenza am2-bm2 chimeric channel bound to rimantadine
Chou, J.J. , Oxenoid, K. , Pielak, R.M.
Primary Citation of Related Structures: 2LJC
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| M2 protein, BM2 protein chimera | A | 35 | Influenza A Virus, Influenza B Virus | RSNDSSDPLVVAASIIGILHFIAWTIGHLNQIKRG |
| M2 protein, BM2 protein chimera | B | 35 | Influenza A Virus, Influenza B Virus | RSNDSSDPLVVAASIIGILHFIAWTIGHLNQIKRG |
| M2 protein, BM2 protein chimera | C | 35 | Influenza A Virus, Influenza B Virus | RSNDSSDPLVVAASIIGILHFIAWTIGHLNQIKRG |
| M2 protein, BM2 protein chimera | D | 35 | Influenza A Virus, Influenza B Virus | RSNDSSDPLVVAASIIGILHFIAWTIGHLNQIKRG |
Method: SOLUTION NMR
Deposited Date: 2011-09-10 Deposition Author(s): Chou, J.J. , Oxenoid, K. , Pielak, R.M.