Pfbd: high-throughput strategy of backbone fold determination for small well-folded proteins in less than a day
PDB DOI: 10.2210/pdb2lj3/pdb
Classification: STRUCTURAL PROTEIN Organism(s): Gallus Gallus
Deposited: 2011-09-04 Deposition Author(s): Hosur, R. , Kumar, D.
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Spectrin alpha chain, brain | A | 63 | Gallus Gallus | MDETGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLDX |
Method: SOLUTION NMR